PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_24939
Common NameKK1_025611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CPP
Protein Properties Length: 895aa    MW: 97537.9 Da    PI: 6.5961
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_24939genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.29.3e-15477515341
            TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                    +k+CnCkkskClk+YC+Cfa g++C++ C C++C N+ e
  C.cajan_24939 477 CKRCNCKKSKCLKLYCDCFAIGAYCTNPCACQGCLNRPE 515
                    89**********************************876 PP

2TCR47.63.2e-15559597139
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                    ++k+gCnCk+skC+kkYCeC++a++ Cs+ C+Ce+C+N 
  C.cajan_24939 559 RHKRGCNCKRSKCQKKYCECYQANVGCSSGCRCEGCMNV 597
                    589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.1E-14475516IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.047476599IPR005172CRC domain
PfamPF036385.6E-11478513IPR005172CRC domain
SMARTSM011149.6E-15559600IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-10561596IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 895 aa     Download sequence    Send to blast
MESPEPSNNN NGSSSASPLN GNHNDYEKSS KVQDSPFYRY VNALSPIPTK APHAAQGFLG  60
LNSPPLVFKS PRISHRETQP MERPQGTQSL SGDIYQSENG GNSLGVAAGD SGKSNSEQPL  120
PERFVADTQK VFDSKNDTNA QNNSSLLSID EYLADPGDID QVYSDDNGVE QSTDAAESSL  180
NGLTQLDKNI SKDGPGDKNK ESLGLSEDSN KVYQEKSAYG QETEKIEGEK NDVQCASQDP  240
TKLESNLAAG DFDKQYCDDP HPQDNKNFTP VWMSDPLQDV QGCEDYNETV STSHVTAENI  300
SQEGSEATLK YHGIRRRCLQ FGEAASNALG SNKPHVKLNA TSNEMKMVKL SEPVTSLCPQ  360
RGSGNLPLTE TGIGVHSNGF INAMPTGQAA TTGVRLSESL QVMKSAPSIR LQRMENVKRS  420
ILSSSSGRPS LVETKNESRE IVTSVSSDAE NSEDFNQPPN PRKKKMRTSV IADNNGCKRC  480
NCKKSKCLKL YCDCFAIGAY CTNPCACQGC LNRPEYAETV SETKKRILAR NANAFAPKIV  540
KANADNMEDE NLTTPSSARH KRGCNCKRSK CQKKYCECYQ ANVGCSSGCR CEGCMNVYGK  600
KDYVSMEKRA LSKERVSNIV QTGSDSTSHN KLEMVASKTN YDAFSPITPS FQFSDQGKEA  660
AKSRVFSSNC LPCPESNVSM IASSANYTSS SEKLHRRHAL LETNEMLTTA PYDSQNNCNN  720
VDMMDQYTPV SHPEPLSGAS SVFSGANEWT NIPQSRLSHG SIRQLPSGSL RWRSSPLTPS  780
TGVGEAHYLQ CPESDNRLFD ILENETPDTL MQASTPMRSV KVNSPTQKRV SPPQIRYHGF  840
GSSSSGGLRP GRKFMLKSVP SFPPLSPCVD SKGNDKEDLG DSESKCSNSA KECPQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236112.10.0cysteine-rich polycomb-like protein
TrEMBLA0A151SCK50.0A0A151SCK5_CAJCA; Protein lin-54 isogeny
STRINGGLYMA17G31399.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.14e-54Tesmin/TSO1-like CXC domain-containing protein